Recombinant Nitrobacter hamburgensis Beta- (1-->2)glucan export ATP-binding/permease protein NdvA (ndvA)

Shipped with Ice Packs
In Stock

Description

Introduction to NdvA

The Recombinant Nitrobacter hamburgensis Beta-(1→2)glucan export ATP-binding/permease protein NdvA (ndvA) is a membrane-associated ATP-binding cassette (ABC) transporter critical for the export of cyclic β-(1→2)glucans. These glucans are essential for bacterial survival under osmotic stress and host interactions in symbiotic or pathogenic relationships . The recombinant form is produced in Escherichia coli systems for biochemical and functional studies .

Functional Role in β-(1→2)Glucan Export

NdvA facilitates the export of β-(1→2)glucans, which are critical for:

  • Osmoadaptation: Maintaining cell turgor under osmotic stress .

  • Host interactions: Enabling biofilm formation and evasion of plant immune responses in symbiotic species like Rhizobium and Agrobacterium .

Mechanism of Action:

  1. ATP hydrolysis by the NBD provides energy for glucan translocation .

  2. TMD pore formation allows passage of glucans across the inner membrane .

Recombinant Production and Purification

  • Expression: Achieved in E. coli with codon optimization for high yield .

  • Purification: Affinity chromatography (His tag) followed by gel filtration .

  • Storage: Lyophilized powder in Tris/PBS buffer with 6% trehalose (pH 8.0); stable at -80°C .

Research Findings and Homology Insights

  • Homology to ABC Transporters: NdvA shares >40% sequence identity with Agrobacterium tumefaciens ChvA and E. coli HlyB, emphasizing its role in export rather than biosynthesis .

  • Functional Complementation: ndvA from Nitrobacter restores β-glucan export in Rhizobium meliloti mutants, confirming conserved mechanisms .

  • Genomic Context: The ndvA gene in Nitrobacter hamburgensis is part of a metabolic island linked to chemolithoautotrophy and nitrite oxidation .

Biological and Industrial Significance

  • Bioremediation: Nitrobacter species are key in nitrogen cycling; NdvA’s role in stress tolerance enhances their utility in wastewater treatment .

  • Biotechnological Applications: Recombinant NdvA aids in studying ABC transporter mechanics for antibiotic efflux pump inhibition strategies .

Key Challenges and Future Directions

  • Structural Resolution: Cryo-EM studies are needed to map TMD-NBD interactions during ATP hydrolysis.

  • Host-Specific Adaptations: Investigate how NdvA’s function varies between free-living Nitrobacter and pathogenic homologs like Agrobacterium .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for fulfillment based on availability.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting to -20°C/-80°C. Our standard glycerol concentration is 50%, which serves as a guideline for your use.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please indicate this during your order to allow for preferential production.
Synonyms
ndvA; Nham_3736; Beta-(1-->2glucan export ATP-binding/permease protein NdvA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-593
Protein Length
full length protein
Species
Nitrobacter hamburgensis (strain DSM 10229 / NCIMB 13809 / X14)
Target Names
ndvA
Target Protein Sequence
MSMLRLYTRVLELLGKEARLGWILAGANLLLAGAQFAEPVLFGRIVDVLSGSPAAGPFGM TSTSPWPLLAVWVVFGLFTILCGVIVALQADRLSHRQRQAVLTGYFEHIMQLPLTYHAGT HSGRLMKVMLQGTDALWRLWLGFFREHFAAMMSLVVLLPLSLTINWRLAILLFALCIVFT MLTTLVVRRTFDMQNEVEAHFSDLSARASDALGNVALVQSFVRVDAEVQGLRFVVDKLLA AQMPVLSWWAVVTVMTRASTTITILAIFAVGIVLNQRGMTSVGEIVMFVSFATMLIQRLE QVVSFINSVFMEAPRLKEFFNVLDAVPAVRDRPDAIDAGRLQGLVEFHDVSFSYDGKRPA VEDLSFVALPGQTIALVGPTGAGKSTAVALLHRAFDPQSGIIKIDGMDIRGLTLASLRRN IGVVFQEALLFDRSIAENLRVGKPDASEEEMRLAASRAQALGFIERADRKFDTHAGERGR MLSGGERQRLSIARALLKDPPILILDEATSALDAVTEAKVNAALDEVMKGRTTFVIAHRL STIRNATRILVFENGRVIENGTFDELLARGGHFARLAKAQFMTQDGSRIGQPS
Uniprot No.

Target Background

Function

Function: Involved in β-(1→2) glucan export. Transmembrane domains (TMDs) form a pore within the inner membrane, while the ATP-binding domain (NBD) provides energy for the process.

Database Links
Protein Families
ABC transporter superfamily, Beta-(1-->2)glucan exporter (TC 3.A.1.108.1) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the NdvA protein in Nitrobacter hamburgensis and what is its primary function?

The NdvA protein in Nitrobacter hamburgensis is a 593-amino acid protein with a molecular mass of approximately 65.1 kDa that belongs to the ABC transporter superfamily, specifically the Beta-(1-->2)glucan exporter (TC 3.A.1.108.1) family . It functions as an ATP-binding/permease protein involved in the export of beta-(1-->2)glucan . The protein contains transmembrane domains (TMD) that form a pore in the inner membrane, while the ATP-binding domain (NBD) is responsible for energy generation required for the transport process .

The function of NdvA can be understood through comparative analysis with homologous proteins in related species. For instance, in Rhizobium meliloti, the ndvA mutant is defective in the production of cyclic extracellular polysaccharide beta-(1-->2)glucan, indicating its essential role in the export mechanism . The protein shows significant homology to bacterial ATP-binding transport proteins, particularly Escherichia coli HlyB, a protein involved in the export of hemolysin .

What is the genomic context of the ndvA gene in Nitrobacter hamburgensis?

The ndvA gene is located in the genomic context of Nitrobacter hamburgensis X14, which possesses a complex genome comprising one chromosome (4.4 Mbp) and three plasmids (294, 188, and 121 kbp) . The genome of N. hamburgensis has a high G+C content of approximately 61.7% . A notable feature of this genome is that over 20% is composed of pseudogenes and paralogs .

How does NdvA relate evolutionarily to other bacterial transport proteins?

The NdvA protein belongs to a larger family of bacterial ATP-binding transport proteins. Comparative analysis reveals:

  • Highest homology with Escherichia coli HlyB protein, which is involved in hemolysin export

  • Significant similarity to the mdr gene product of mammalian cells, also thought to be involved in export functions

  • Functional relatedness to the chvA locus of Agrobacterium tumefaciens, as the ndvA locus of Rhizobium meliloti can substitute for chvA

These evolutionary relationships suggest that NdvA is part of a conserved mechanism for polysaccharide export across different bacterial species. The NdvA protein contains characteristic motifs of the ABC transporter superfamily, including nucleotide-binding domains that interact with ATP and transmembrane domains that form the translocation pathway .

A "Nitrobacter subcore" genome analysis identified 116 genes that are unique to Nitrobacter species when compared to close evolutionary relatives like Bradyrhizobium japonicum and Rhodopseudomonas palustris . Many of these subcore genes, which may include components related to NdvA function, have diverged significantly from or have origins outside the alphaproteobacterial lineage .

What is the role of beta-(1-->2)glucan in bacterial physiology?

Beta-(1-->2)glucan is a cyclic extracellular polysaccharide that serves multiple functions in bacterial physiology:

  • Symbiotic Interactions: In Rhizobium meliloti, beta-(1-->2)glucan is fundamentally important for normal alfalfa nodule development. Mutants defective in ndvA form small, white, empty nodules on alfalfa roots and exhibit reduced motility .

  • Osmotic Adaptation: Cyclic beta-(1-->2)glucans likely function in osmotic adaptation by gram-negative bacteria . They may help maintain cellular homeostasis under varying environmental conditions.

  • Cell Surface Properties: These polysaccharides contribute to cell surface characteristics that influence bacterial interactions with the environment and host organisms.

The export of beta-(1-->2)glucan, facilitated by NdvA, appears to be a crucial process for maintaining proper physiological functions. In ndvA mutants, a 235,000-dalton protein intermediate involved in beta-(1-->2)glucan synthesis remains active in vitro, but the final export of the polysaccharide is compromised . This indicates that NdvA specifically functions in the export pathway rather than in synthesis.

What expression systems are most effective for producing recombinant NdvA protein for structural and functional studies?

Multiple expression systems have been developed for recombinant NdvA production, each with distinct advantages:

Table 1: Comparison of Expression Systems for Recombinant NdvA Production

Expression SystemAdvantagesConsiderationsProtein ProductReference
E. coliHigh yield, cost-effective, rapid expressionMay lack post-translational modifications, potential inclusion body formationNative and biotinylated forms available
YeastBetter folding of complex proteins, some post-translational modificationsLonger expression time, more complex media requirementsAvailable for research applications
BaculovirusSuperior folding of complex multi-domain proteinsMore expensive, technically demandingAvailable for specialized applications
Mammalian cellsNative-like post-translational modificationsHighest cost, longest production timeAvailable for specialized applications

When studying recombinant NdvA, researchers should consider using the AviTag-BirA technology for biotinylation, which enables specific protein immobilization and interaction studies . This approach catalyzes an amide linkage between biotin and a specific lysine residue of the AviTag peptide.

What methodologies can researchers employ to verify the functionality of recombinant NdvA in vitro?

Verifying the functionality of recombinant NdvA requires multiple complementary approaches:

  • ATP Hydrolysis Assays: Since NdvA functions as an ATP-binding protein, measuring its ATPase activity is crucial. Colorimetric assays that detect inorganic phosphate release can quantify ATP hydrolysis rates, which should increase in the presence of the transport substrate.

  • Reconstitution in Proteoliposomes: Purified recombinant NdvA can be reconstituted into liposomes to create a simplified membrane system. Transport activity can then be assessed by measuring the uptake or export of radiolabeled or fluorescently tagged beta-(1-->2)glucan or analogues.

  • Substrate Binding Assays: Techniques such as surface plasmon resonance (SPR) or isothermal titration calorimetry (ITC) can determine binding affinities between NdvA and potential substrates or ATP.

  • Complementation Studies: Functional recombinant NdvA should complement ndvA mutants in various bacteria. For example, transformation of R. meliloti ndvA mutants with functional ndvA should restore beta-(1-->2)glucan production and normal symbiotic capabilities .

  • ATPase Stimulation Assays: Functional ABC transporters typically show increased ATPase activity in the presence of transport substrates. Measuring ATPase activity with and without beta-(1-->2)glucan can provide evidence of functional coupling.

When assessing functionality, it's important to note that NdvA maintains active 235,000-dalton membrane intermediate in ndvA mutants, but fails to export beta-(1-->2)glucan . This observation can serve as a control point in experimental designs.

What experimental challenges arise when creating and analyzing NdvA mutants in Nitrobacter hamburgensis?

Creating and analyzing NdvA mutants in Nitrobacter hamburgensis presents several significant challenges:

  • Genetic Manipulation Difficulties: N. hamburgensis has a complex genome with one chromosome and three plasmids . Over 20% of its genome consists of pseudogenes and paralogs , which complicates targeted gene manipulation. Additionally, the genome contains numerous restriction-modification systems (11 in N. hamburgensis, 2.39 RM genes per Mbp) , which may degrade foreign DNA introduced during transformation.

  • Growth Characteristics: As a facultative chemolithoautotroph, N. hamburgensis has specific growth requirements and potentially slow growth rates that extend experimental timelines .

  • Phenotype Analysis: The phenotypic effects of ndvA mutations may be subtle or context-dependent. While in Rhizobium meliloti, ndvA mutations lead to clear phenotypes (reduced motility, empty nodules) , the phenotypic consequences in N. hamburgensis might differ due to its distinct ecological niche.

  • Functional Redundancy: The presence of multiple transporters with overlapping functions could mask the effects of ndvA mutations. The N. hamburgensis genome contains extensive gene duplications, including multiple copies of genes involved in key metabolic functions .

  • Complex Regulation: The regulation of ndvA expression may involve multiple factors, making it difficult to distinguish primary from secondary effects when analyzing mutants.

To overcome these challenges, researchers should consider combining traditional genetic approaches with newer techniques such as CRISPR-Cas9 for precise genome editing, and employ multiple phenotypic assays to detect subtle changes in beta-(1-->2)glucan export and related functions.

How does the function of NdvA in Nitrobacter hamburgensis compare with homologous proteins in different bacterial species?

The function of NdvA shows both conservation and divergence across bacterial species:

Table 2: Comparative Function of NdvA Homologs Across Bacterial Species

SpeciesHomologous ProteinFunctionPhenotype of MutationUnique FeaturesReference
Nitrobacter hamburgensisNdvABeta-(1-->2)glucan exportNot fully characterized593 amino acids, 65.1 kDa
Rhizobium melilotiNdvABeta-(1-->2)glucan exportReduced motility, defective nodulationCan substitute for chvA in A. tumefaciens
Agrobacterium tumefaciensChvABeta-(1-->2)glucan exportReduced virulenceInvolved in plant pathogenesis
Escherichia coliHlyBHemolysin exportReduced hemolytic activityHighest homology to NdvA
Rhodopseudomonas palustrisNdvABeta-(1-->2)glucan exportNot fully characterizedAvailable as recombinant protein

In R. meliloti, ndvA mutants retain an active 235,000-dalton membrane intermediate but fail to export beta-(1-->2)glucan . This suggests that NdvA specifically functions in the export pathway rather than in synthesis, a distinction that appears to be conserved across species.

What advanced techniques are recommended for investigating the structure-function relationship of NdvA?

To elucidate the structure-function relationship of NdvA, researchers should employ a multi-tiered approach:

  • Cryo-Electron Microscopy (Cryo-EM): This technique can resolve the structure of membrane proteins in a near-native environment. For NdvA, cryo-EM could reveal the conformation of transmembrane domains and substrate-binding sites at near-atomic resolution.

  • Site-Directed Mutagenesis: Systematic mutation of conserved residues, particularly in the ATP-binding domain (NBD) and transmembrane domains (TMD), can identify critical amino acids for function. The AlphaFold model with a pLDDT score of 88.44 provides guidance for targeting specific residues .

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS): This technique can map conformational changes in NdvA upon ATP binding or during the transport cycle, providing insights into the mechanism of action.

  • Single-Molecule FRET Analysis: By labeling different domains of NdvA with fluorophores, researchers can monitor conformational changes during the transport cycle in real-time.

  • Molecular Dynamics Simulations: Using the AlphaFold-predicted structure as a starting point, simulations can predict how NdvA interacts with membranes, substrates, and ATP, and how it undergoes conformational changes during transport.

  • Cross-Linking Mass Spectrometry: This approach can identify proximity relationships between domains and interaction partners of NdvA in its native environment.

These techniques should be applied in concert, as each provides complementary information about different aspects of structure-function relationships. The challenge lies in integrating these diverse data types into a coherent model of NdvA function.

How can researchers investigate the interaction between NdvA and other cellular components involved in beta-(1-->2)glucan biosynthesis and export?

Investigating the interactions between NdvA and other cellular components requires specialized techniques for membrane protein complexes:

  • Co-Immunoprecipitation (Co-IP) with Membrane-Compatible Detergents: Using antibodies against NdvA to pull down associated proteins can identify interaction partners. The choice of detergent is critical for maintaining native interactions.

  • Bacterial Two-Hybrid Analysis: Modified for membrane proteins, this system can detect protein-protein interactions in a cellular context.

  • Proximity Labeling Techniques: Methods such as BioID or APEX2 can identify proteins in close proximity to NdvA in living cells by attaching a biotin ligase or peroxidase to NdvA, which then biotinylates nearby proteins.

  • Fluorescence Microscopy with Co-Localization Analysis: Fluorescently tagged NdvA and potential interaction partners can be visualized to determine if they occupy the same subcellular locations.

  • Proteomics Analysis of Membrane Fractions: Comparative proteomics of membrane fractions from wild-type and ndvA mutant strains can identify proteins whose abundance or localization changes in the absence of NdvA.

In R. meliloti, a 235,000-dalton protein intermediate involved in beta-(1-->2)glucan synthesis remains active in ndvA mutants , suggesting this protein operates upstream of NdvA in the biosynthetic pathway. This observation provides a starting point for investigating the sequential assembly of the biosynthesis and export machinery.

What is known about the regulation of ndvA gene expression in response to environmental conditions?

The regulation of ndvA expression in Nitrobacter hamburgensis remains largely uncharacterized, but insights can be drawn from related systems:

  • Genome Context Analysis: The genomic neighborhood of ndvA may contain regulatory elements. N. hamburgensis has a moderate abundance of signaling proteins compared to related species , suggesting complex regulatory networks.

  • Environmental Responsiveness: In related bacteria, beta-(1-->2)glucan production responds to osmotic conditions , suggesting that ndvA expression might be regulated by osmotic stress. N. hamburgensis's ability to grow in diverse environments (aerobically and anaerobically) implies adaptive regulation of key transporters like NdvA.

  • Transcription Factors: The N. hamburgensis genome encodes fewer FecI-like extracytoplasmic transcription factors (ECFs) than N. winogradskyi . Unlike N. winogradskyi, none of the ECF proteins in N. hamburgensis are adjacent to iron-related proteins, suggesting different regulatory circuits.

  • Metabolic Integration: As a facultative chemolithoautotroph, N. hamburgensis can switch between different metabolic modes . This metabolic flexibility likely involves coordinated regulation of transporters like NdvA to adapt to changing energy sources.

To study ndvA regulation experimentally, researchers should consider:

  • Reporter gene fusions to monitor ndvA promoter activity

  • Transcriptomics under varying environmental conditions

  • Identification of transcription factors that bind to the ndvA promoter region

  • Analysis of post-transcriptional regulatory mechanisms

What approaches can be used to study the membrane topology and assembly of NdvA in bacterial membranes?

Understanding the membrane topology and assembly of NdvA requires specialized techniques for membrane proteins:

  • Cysteine Scanning Mutagenesis: By systematically replacing residues with cysteine and assessing their accessibility to membrane-impermeable sulfhydryl reagents, researchers can map which portions of NdvA are exposed to different cellular compartments.

  • Fusion Protein Analysis: Creating fusions between NdvA segments and reporter proteins (such as GFP or alkaline phosphatase) whose activity depends on their cellular location can reveal the topology of transmembrane segments.

  • Protease Protection Assays: By treating membrane vesicles with proteases and identifying protected fragments by mass spectrometry, researchers can determine which regions of NdvA are exposed or protected.

  • Fluorescence Resonance Energy Transfer (FRET): By labeling different domains of NdvA with fluorophores, researchers can measure distances between domains and monitor conformational changes.

  • Electron Paramagnetic Resonance (EPR) Spectroscopy: Site-directed spin labeling combined with EPR can provide information about the dynamics and environment of specific residues in the membrane.

  • In vivo Photocrosslinking: By incorporating photoreactive amino acids at specific positions in NdvA, researchers can capture transient interactions with lipids or other proteins under physiological conditions.

The AlphaFold structural model with varying confidence levels across different regions can guide these experimental approaches by highlighting domains with uncertain conformations that require experimental validation.

How might NdvA function be affected by membrane composition and what methodologies can address this question?

The function of membrane transporters like NdvA is intimately linked to membrane composition:

  • Lipidomic Analysis: Comparing the lipid composition of membranes in wild-type and ndvA mutant strains can reveal lipid preferences or alterations caused by NdvA dysfunction.

  • Reconstitution in Defined Liposomes: Purified NdvA can be reconstituted in liposomes with varying lipid compositions to determine optimal conditions for activity. Transport assays using these proteoliposomes can directly measure how lipid composition affects function.

  • Fluorescence Anisotropy Measurements: By incorporating fluorescent probes into membranes, researchers can measure membrane fluidity and how it changes with NdvA activity or in different lipid environments.

  • Atomic Force Microscopy (AFM): This technique can visualize the organization of NdvA in membranes and detect lipid-dependent structural changes or oligomerization.

  • Molecular Dynamics Simulations: Computational approaches can predict how NdvA interacts with different lipid species and how these interactions affect protein conformation and function.

N. hamburgensis, as a member of the alphaproteobacteria, likely has a membrane composition that includes various phospholipids and potentially hopanoids. The membrane composition may vary with growth conditions, potentially affecting NdvA activity and requiring coordinated regulation of lipid biosynthesis and transporter function.

What approaches can elucidate the evolutionary conservation and specialization of NdvA across the bacterial domain?

Understanding the evolutionary trajectory of NdvA requires integrative approaches:

  • Phylogenomic Analysis: Comprehensive phylogenetic trees based on NdvA sequences from diverse bacteria can reveal evolutionary relationships and potential horizontal gene transfer events. The "Nitrobacter subcore" genome analysis identified 116 genes unique to Nitrobacter species , providing context for NdvA evolution.

  • Structural Conservation Mapping: Using the AlphaFold model as a template, researchers can map conserved residues onto the structure to identify functionally critical regions preserved through evolution.

  • Functional Complementation Studies: Testing whether NdvA from different species can complement ndvA mutants in heterologous hosts can reveal functional conservation or specialization.

  • Synteny Analysis: Examining the genomic context of ndvA across species can reveal conserved gene clusters or regulatory elements. In Nitrobacter species, a "subcore" inventory revealed genes with origins outside the alphaproteobacterial lineage , suggesting complex evolutionary histories.

  • Selection Pressure Analysis: Calculating the ratio of non-synonymous to synonymous substitutions (dN/dS) across NdvA sequences can identify regions under purifying or diversifying selection.

  • Domain Architecture Comparison: Analyzing the arrangement of functional domains in NdvA homologs can reveal evolutionary innovations or constraints.

The extensive genomic analysis of Nitrobacter species has shown that many "subcore" genes have diverged significantly from, or have origins outside, the alphaproteobacterial lineage . This suggests potential horizontal gene transfer events in the evolutionary history of genes like ndvA, which may have contributed to the metabolic and ecological specialization of Nitrobacter species.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.